{"product_id":"proteintech-18087-1-ap","title":"Proteintech, 18087-1-AP, MMP26 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MMP26 (18087-1-AP) by Proteintech is a Polyclonal antibody targeting MMP26 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human samples\n18087-1-AP targets MMP26 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: SKOV-3 cells,  HEK-293 cells,  human placenta tissue\nPositive IHC detected in: human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: SKOV-3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMMP26(matrix metallopeptidase 26) may hydrolyze collagen type IV, fibronectin, fibrinogen, beta-casein, type I gelatin and alpha-1 proteinase inhibitor.MMP26 is expressed in placenta and uterus and is widely expressed in malignant tumors from different sources as well as in diverse tumor cell lines(PMID: 10987280).The proenzyme without the signal peptide has a calculated molecular mass of 29 kDa and the processed enzyme has a calculated molecular mass of 19 kDa(PMID:15574774).This antibody is specific to MMP26.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag12806 Product name: Recombinant human MMP26 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 24-262 aa of BC101541 Sequence: ADHKGWDFVEGYFHQFFLTKKESPLLTQETQTQLLQQFHRNGTDLLDMQMHALLHQPHCGVPDGSDTSISPGRCKWNKHTLTYRIINYPHDMKPSAVKDSIYNAVSIWSNVTPLIFQQVQNGDADIKVSFWQWAHEDGWPFDGPGGILGHAFLPNSGNPGVVHFDKNEHWSASDTGYNLFLVATHEIGHSLGLQHSGNQSSIMYPTYWYHDPRTFQLSADDIQRIQHLYGEKCSSDIP Predict reactive species\nFull Name: matrix metallopeptidase 26\nCalculated Molecular Weight: 262 aa, 30 kDa\nObserved Molecular Weight: 19 kDa\nGenBank Accession Number: BC101541\nGene Symbol: MMP26\nGene ID (NCBI): 56547\nRRID: AB_2878495\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NRE1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869560131753,"sku":"18087-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-18087-1-ap","provider":"Iright","version":"1.0","type":"link"}