{"product_id":"proteintech-18102-1-ap","title":"Proteintech, 18102-1-AP, SGCG Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SGCG (18102-1-AP) by Proteintech is a Polyclonal antibody targeting SGCG in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples\n18102-1-AP targets SGCG in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse heart tissue, human skeletal muscle tissue,  human heart tissue,  mouse skeletal muscle tissue,  rat heart tissue\nPositive IP detected in: mouse heart tissue\nPositive IHC detected in: human heart tissue,  human kidney tissue,  human lung tissue,  human ovary tissue,  human placenta tissue,  human skin tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag12402 Product name: Recombinant human SGCG protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-291 aa of BC074777 Sequence: MVREQYTTATEGICIERPENQYVYKIGIYGWRKRCLYLFVLLLLIILVVNLALTIWILKVMWFSPAGMGHLCVTKDGLRLEGESEFLFPLYAKEIHSRVDSSLLLQSTQNVTVNARNSEGEVTGRLKVGPKMVEVQNQQFQINSNDGKPLFTVDEKEVVVGTDKLRVTGPEGALFEHSVETPLVRADPFQDLRLESPTRSLSMDAPRGVHIQAHAGKIEALSQMDILFHSSDGMLVLDAETVCLPKLVQGTWGPSGSSQSLYEICVCPDGKLYLSVAGVSTTCQEHSHICL Predict reactive species\nFull Name: sarcoglycan, gamma (35kDa dystrophin-associated glycoprotein)\nCalculated Molecular Weight: 291 aa, 32 kDa\nObserved Molecular Weight: 35-38 kDa\nGenBank Accession Number: BC074777\nGene Symbol: SGCG\nGene ID (NCBI): 6445\nRRID: AB_2286186\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q13326\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868988854441,"sku":"18102-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-18102-1-ap","provider":"Iright","version":"1.0","type":"link"}