{"product_id":"proteintech-18104-1-ap","title":"Proteintech, 18104-1-AP, IL-20 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe IL-20 (18104-1-AP) by Proteintech is a Polyclonal antibody targeting IL-20 in WB, IHC, ELISA applications with reactivity to human samples\n18104-1-AP targets IL-20 in WB, IF, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells\nPositive IHC detected in: human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nInterleukin-20 (IL-20) is a protein belonging to the IL-10 family of cytokines. IL-20 receptor (IL-20R) and IL-20 are expressed in several normal tissue types, including the lung, skin, and kidney. IL-20 is a cytokine structurally related to interleukin 10. IL-20 is produced by activated keratinocytes and monocytes and transmits an intracellular signal through two distinct cell-surface receptor complexes on keratinocytes and other epithelial cells. IL-20 can stimulate STAT3 activation in keratinocytes. IL-20 regulates proliferation and differentiation of keratinocytes during inflammation, particularly inflammation associated with the skin. In addition, IL-20 also causes cell expansion of multipotential hematopoietic progenitor cells. IL-20 is highly associated with potent inflammatory diseases such as psoriasis, contact hypersensitivity, rheumatoid arthritis, and atherosclerosis.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag12447 Product name: Recombinant human IL-20 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 26-176 aa of BC074949 Sequence: KTLNLGSCVIATNLQEIRNGFSEIRGSVQAKDGNIDIRILRRTESLQDTKPANRCCLLRHLLRLYLDRVFKNYQTPDHYTLRKISSLANSFLTIKKDLRLCHAHMTCHCGEEAMKKYSQILSHFEKLEPQAAVVKALGELDILLQWMEETE Predict reactive species\nFull Name: interleukin 20\nCalculated Molecular Weight: 406 aa, 44 kDa\nGenBank Accession Number: BC074949\nGene Symbol: IL-20\nGene ID (NCBI): 50604\nRRID: AB_2878501\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NYY1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869697593513,"sku":"18104-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-18104-1-ap","provider":"Iright","version":"1.0","type":"link"}