{"product_id":"proteintech-18113-1-ap","title":"Proteintech, 18113-1-AP, Uroguanylin Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Uroguanylin (18113-1-AP) by Proteintech is a Polyclonal antibody targeting Uroguanylin in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n18113-1-AP targets Uroguanylin in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse pancreas tissue,  mouse colon tissue,  mouse small intestine tissue,  rat pancreas tissue\nPositive IHC detected in: human pancreas cancer tissue, human kidney tissue,  human stomach tissue,  human colon cancer tissue,  mouse small intestine tissue,  mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:400-1:1600\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nUroguanylin, also named as GUCA2B, is a candidate intestinal natriuretic hormone that controls the sodium and water balance between the intestine and the kidneys. It has been reported that the uroguanylin knockout mouse exhibits elevated blood pressure. Therefore, the GUCA2B gene is thought to be a susceptibility gene for essential hypertension (EH).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag12589 Product name: Recombinant human Uroguanylin protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 24-112 aa of BC093779 Sequence: TQSVYIQYQGFRVQLESMKKLSDLEAQWAPSPRLQAQSLLPAVCHHPALPQDLQPVCASQEASSIFKTLRTIANDDCELCVNVACTGCL Predict reactive species\nFull Name: guanylate cyclase activator 2B (uroguanylin)\nCalculated Molecular Weight: 112 aa, 12 kDa\nObserved Molecular Weight: 12-13 kDa\nGenBank Accession Number: BC093779\nGene Symbol: Uroguanylin\nGene ID (NCBI): 2981\nRRID: AB_10858615\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q16661\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869439512745,"sku":"18113-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-18113-1-ap","provider":"Iright","version":"1.0","type":"link"}