{"product_id":"proteintech-18170-1-ap","title":"Proteintech, 18170-1-AP, Resistin Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Resistin (18170-1-AP) by Proteintech is a Polyclonal antibody targeting Resistin in IHC, ELISA applications with reactivity to human samples\n18170-1-AP targets Resistin in IHC, IF, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: human lung tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nResistin is a member of the resistin-like molecule family (RELMs) that includes three additional proteins, RELM-α, RELM-β, RELM-y . Resistin is almost exclusively expressed in white adipocytes in mice, whereas macrophages are the primary source in humans . In a variety of pathophysiologic states, particularly in type 2 diabetes mellitus and in chronic kidney disease, the serum concentration of resistin is increased. (PMID: 32822824, PMID: 19708984)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag12822 Product name: Recombinant human RETN protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 26-108 aa of BC101560 Sequence: EAINERIQEVAGSLIFRAISSIGLECQSVTSRGDLATCPRGFAVTGCTCGSACGSWDVRAETTCHCQCAGMDWTGARCCRVQP Predict reactive species\nFull Name: resistin\nCalculated Molecular Weight: 108 aa, 11 kDa\nGenBank Accession Number: BC101560\nGene Symbol: RETN\nGene ID (NCBI): 56729\nRRID: AB_2918058\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9HD89\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869493514409,"sku":"18170-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-18170-1-ap","provider":"Iright","version":"1.0","type":"link"}