{"product_id":"proteintech-18190-1-ap","title":"Proteintech, 18190-1-AP, MEOX1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MEOX1 (18190-1-AP) by Proteintech is a Polyclonal antibody targeting MEOX1 in WB, ELISA applications with reactivity to mouse, rat samples\n18190-1-AP targets MEOX1 in WB, ELISA applications and shows reactivity with mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, mouse liver tissue,  rat brain tissue,  rat liver tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:16000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMEOX1 (mesenchyme homeobox 1), also known as KFS2. It is expected to be located in nucleus and cytoplasm, and the protein is enriched in the adipose tissue, breast and heart muscle. The protein may play a role in the molecular signaling network regulating somite development. Mesodermal transcription factor that plays a key role in so mitogenesis and is specifically required for sclerotome development. Required for maintenance of the sclerotome polarity and formation of the cranio-cervical joints (PMID: 23290072, 24073994). The molecular weight of MEOX1 is 28 kDa, and it can recognize the band of 35 kDa (PMID:29678882).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse, rat\nCited Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag12910 Product name: Recombinant human MEOX1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-254 aa of BC069474 Sequence: MDPAASSCMRSLQPPAPVWGCLRNPHSEGNGASGLPHYPPTPFSFHQKPDFLATATAAYPDFSASCLAATPHSLPQEEHIFTEQHPAFPQSPNWHFPVSDARRRPNSGPAGGSKEMGTSSLGLVDTTGGPGDDYGVLGSTANETEKKSSRRRKESSDNQENRGKPEGSSKARKERTAFTKEQLRELEAEFAHHNYLTRLRRYEIAVNLDLSERQVKVWFQNRRMKWKRVKGGQPISPNGQDPEDGDSTASPSSE Predict reactive species\nFull Name: mesenchyme homeobox 1\nCalculated Molecular Weight: 254 aa, 28 kDa\nObserved Molecular Weight: 28-35 kDa\nGenBank Accession Number: BC069474\nGene Symbol: MEOX1\nGene ID (NCBI): 4222\nRRID: AB_3085559\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P50221\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869709160617,"sku":"18190-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-18190-1-ap","provider":"Iright","version":"1.0","type":"link"}