{"product_id":"proteintech-18207-1-ap","title":"Proteintech, 18207-1-AP, CBLN1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CBLN1 (18207-1-AP) by Proteintech is a Polyclonal antibody targeting CBLN1 in WB, ELISA applications with reactivity to human, mouse, rat samples\n18207-1-AP targets CBLN1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: SH-SY5Y cells, U-87 MG cells,  Neuro-2a cells,  mouse brain tissue,  rat brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCBLN1 (Cerebellin-1) is also named as Precerebellin. CBLN1 is a newly identified synaptic organizer belonging to the C1q family. Cbln1 was recently identified as the missing ligand for the orphan glutamate receptor δ2 (GluD2) (PMID: 21342763). In the cerebellum, Cbln1 is produced and secreted from granule cells and works as a strong synapse organizer between Purkinje cells and parallel fibers, the axons of the granule cells (PMID: 24607546). The glycosylation modification of CBLN1 resulted in a larger molecular weight.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag12835 Product name: Recombinant human CBLN1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 20-193 aa of BC093692 Sequence: RGQNETEPIVLEGKCLVVCDSNPTSDPTGTALGISVRSGSAKVAFSAIRSTNHEPSEMSNRTMIIYFDQVLVNIGNNFDSERSTFIAPRKGIYSFNFHVVKVYNRQTIQVSLMLNGWPVISAFAGDQDVTREAASNGVLIQMEKGDRAYLKLERGNLMGGWKYSTFSGFLVFPL Predict reactive species\nFull Name: cerebellin 1 precursor\nCalculated Molecular Weight: 193 aa, 21 kDa\nObserved Molecular Weight: 50 kDa\nGenBank Accession Number: BC093692\nGene Symbol: CBLN1\nGene ID (NCBI): 869\nRRID: AB_3669294\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P23435\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46885852315817,"sku":"18207-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-18207-1-ap","provider":"Iright","version":"1.0","type":"link"}