{"product_id":"proteintech-18223-1-ap","title":"Proteintech, 18223-1-AP, GNG13 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GNG13 (18223-1-AP) by Proteintech is a Polyclonal antibody targeting GNG13 in WB, ELISA applications with reactivity to human, mouse, rat samples\n18223-1-AP targets GNG13 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, mouse retina tissue,  rat brain tissue,  rat retina tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGNG13 (Guanine nucleotide-binding protein G (G gamma 13)) is a gene that encodes a gamma subunit of a heterotrimeric G protein. It is expressed in taste, retinal, and neuronal tissues and is crucial for taste transduction. In the main olfactory epithelium (MOE), most olfactory sensory neurons (OSNs) express G proteins consisting of Gαolf and Gβ1γ13. Conditional knockout of the Gng13 gene in mice significantly altered the MOE's gene expression profile and impaired the mutant animals' food - seeking capabilities (PMID: 30157062).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag13007 Product name: Recombinant human GNG13 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-67 aa of BC093760 Sequence: MEEWDVPQMKKEVESLKYQLAFQREMASKTIPELLKWIEDGIPKDPFLNPDLMKNNPWVEKGKCTIL Predict reactive species\nFull Name: guanine nucleotide binding protein (G protein), gamma 13\nCalculated Molecular Weight: 67 aa, 8 kDa\nObserved Molecular Weight: 8 kDa\nGenBank Accession Number: BC093760\nGene Symbol: GNG13\nGene ID (NCBI): 51764\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9P2W3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887653867689,"sku":"18223-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-18223-1-ap","provider":"Iright","version":"1.0","type":"link"}