{"product_id":"proteintech-18248-1-ap","title":"Proteintech, 18248-1-AP, CLEC5A Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CLEC5A (18248-1-AP) by Proteintech is a Polyclonal antibody targeting CLEC5A in WB, ELISA applications with reactivity to human, mouse samples\n18248-1-AP targets CLEC5A in WB, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: J774A.1 cells, K-562 cells,  THP-1 cells,  RAW 264.7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nC-type lectin domain family 5 member A (CLEC5A, also known as CLECSF5 and MDL1) is a spleen tyrosine kinase (Syk)-coupled receptor abundantly expressed by monocytes, macrophages and neutrophils (PMID: 10449773). It has a pivotal function in activating multiple aspects of innate immunity against bacterial invasion (PMID: 28824166). Both in vitro and in vivo evidence supported that CLEC5A was involved in glioblastoma pathogenesis via regulation of PI3K\/Akt pathway (PMID: 30834619). It appeared as a protein band of ~36 kDa because of glycosylation, while its predicted molecular weight is 22 kDa (PMID: 25877931; 19074552).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag13025 Product name: Recombinant human CLEC5A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 32-188 aa of BC112099 Sequence: NKSNDGFTTTRSYGTVSQIFGSSSPSPNGFITTRSYGTVCPKDWEFYQARCFFLSTSESSWNESRDFCKGKGSTLAIVNTPEKLKFLQDITDAEKYFIGLIYHREEKRWRWINNSVFNGNVTNQNQNFNCATIGLTKTFDAASCDISYRRICEKNAK Predict reactive species\nFull Name: C-type lectin domain family 5, member A\nCalculated Molecular Weight: 188 aa, 22 kDa\nObserved Molecular Weight: 36 kDa\nGenBank Accession Number: BC112099\nGene Symbol: CLEC5A\nGene ID (NCBI): 23601\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NY25\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46886615089321,"sku":"18248-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-18248-1-ap","provider":"Iright","version":"1.0","type":"link"}