{"product_id":"proteintech-18258-1-ap","title":"Proteintech, 18258-1-AP, ATG13 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ATG13 (18258-1-AP) by Proteintech is a Polyclonal antibody targeting ATG13 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n18258-1-AP targets ATG13 in WB, IHC, IF\/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: SH-SY5Y cells, BGC-823 cells,  HeLa cells,  human brain tissue,  mouse cerebellum tissue,  mouse testis tissue,  mouse thymus tissue,  Jurkat cells,  HEK-293 cells,  MCF-7 cells\nPositive IP detected in: SH-SY5Y cells\nPositive IHC detected in: mouse heart tissue, mouse brain tissue,  human brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: SH-SY5Y cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nATG13 is one component protein of the ULK1 complex which is required for autophagosome formation and mitophagy. ATG13 has two nutrient regulatory phosphorylation sites and the phosphorylation status of ATG13 affect regulation of autophagy by modulating enzyme activity and cellular localization of ULK1. Besides, it has been reported the nonautophagic function of ATG13 on cardiac development for ATG13-deficient embryos show myocardial growth defects.(PMID:27387056, 26801615, 26644405)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag13090 Product name: Recombinant human KIAA0652 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 131-481 aa of BC001331 Sequence: ITRVTPAYRLSRKQGHEYVILYRIYFGEVQLSGLGEGFQTVRVGTVGTPVGTITLSCAYRINLAFMSTRQFERTPPIMGIIIDHFVDRPYPSSSPMHPCNYRTAGEDTGVIYPSVEDSQEVCTTSFSTSPPSQLMVPGKEGGVPLAPNQPVHGTQADQERLATCTPSDRTHCAATPSSSEDTETVSNSSEGRASPHDVLETIFVRKVGAFVNKPINQVTLTSLDIPFAMFAPKNLELEDTDPMVNPPDSPETESPLQGSLHSDGSSGGSSGNTHDDFVMIDFKPAFSKDDILPMDLGTFYREFQNPPQLSSLSIDIGAQSMAEDLDSLPEKLAVHEKNVREFDAFVETLQ* Predict reactive species\nFull Name: KIAA0652\nCalculated Molecular Weight: 57 kDa\nObserved Molecular Weight: 57-63 kDa\nGenBank Accession Number: BC001331\nGene Symbol: ATG13\nGene ID (NCBI): 9776\nRRID: AB_2130658\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O75143\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868878393513,"sku":"18258-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-18258-1-ap","provider":"Iright","version":"1.0","type":"link"}