{"product_id":"proteintech-18284-1-ap","title":"Proteintech, 18284-1-AP, HSP27 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe HSP27 (18284-1-AP) by Proteintech is a Polyclonal antibody targeting HSP27 in WB, IHC, IF\/ICC, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples\n18284-1-AP targets HSP27 in WB, IHC, IF\/ICC, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, HeLa cells,  C6 cells,  mouse liver tissue,  HepG2 cells,  U2OS cells\nPositive IHC detected in: human lung cancer tissue, human liver cancer tissue,  human gliomas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells, MCF-7 cells\nPositive FC (Intra) detected in: MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.50 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHSPB1, also known as heat shock protein 27 (HSP27), belongs to the small heat shock protein family which is induced in response to environmental challenges or\/and developmental transitions. It is also an anti-apoptotic protein that plays crucial roles in tumorigenesis and cell survival and is reported to be an independent prognosis marker for cancer. Recently HSPB1 has been found to be a valuable marker for melanoma. In addition to the predicted 27 kDa, an extra 50-55 kDa representing dimeric form of HSPB1 may also be observed (PMID: 21353161). It's notable that mouse HSP27 is also named HSP25 and has the predicted MW between 19-23 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, pig, chicken, fish\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag13161 Product name: Recombinant human HSPB1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-205 aa of BC012768 Sequence: MTERRVPFSLLRGPSWDPFRDWYPHSRLFDQAFGLPRLPEEWSQWLGGSSWPGYVRPLPPAAIESPAVAAPAYSRALSRQLSSGVSEIRHTADRWRVSLDVNHFAPDELTVKTKDGVVEITGKHEERQDEHGYISRCFTRKYTLPPGVDPTQVSSSLSPEGTLTVEAPMPKLATQSNEITIPVTFESRAQLGGPEAAKSDETAAK Predict reactive species\nFull Name: heat shock 27kDa protein 1\nCalculated Molecular Weight: 19-23 kDa\nObserved Molecular Weight: 27 kDa\nGenBank Accession Number: BC012768\nGene Symbol: HSPB1\nGene ID (NCBI): 3315\nRRID: AB_2295540\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P04792\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868848148649,"sku":"18284-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-18284-1-ap","provider":"Iright","version":"1.0","type":"link"}