{"product_id":"proteintech-18424-1-ap","title":"Proteintech, 18424-1-AP, NOL7 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NOL7 (18424-1-AP) by Proteintech is a Polyclonal antibody targeting NOL7 in WB, IF\/ICC, ELISA applications with reactivity to human samples\n18424-1-AP targets NOL7 in WB, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, HeLa cells\nPositive IF\/ICC detected in: U2OS cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNOL7 (nucleolar protein 7) is localized in both the nucleolus and nucleoplasm, with its nucleolar localization being RNA-dependent. Its function in the nucleolus is likely related to maintaining nucleolar structure and cell growth, while its role in the nucleoplasm may be associated with anti-angiogenic effects. Additionally, NOL7 is involved in the accumulation of early pre-rRNA and the processing of pre-18S rRNA, which are crucial for maintaining nucleolar function and cell growth.\nThe expression of NOL7 is regulated by various transcription factors, including c-myc and RXRα. In cervical cancer, NOL7 transcription is also positively regulated by the RB tumor suppressor gene. The NOL7 gene encodes three distinct splice variants, each with different intracellular localizations that may affect their functions.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag13272 Product name: Recombinant human NOL7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-257 aa of BC023517 Sequence: MVQLRPRASRAPASAEAMVDEGQLASEEEEAEHGLLLGQPSSGAAAEPLEEDEEGDDEFDDEAPEELTFASAQAEAREEERRVRETVRRDKTLLKEKRKRREELFIEQKKRKLLPDTILEKLTTASQTNIKKSPGKVKEVNLQKKNEDCEKGNDSKKVKVQKVQSVSQNKSYLAVRLKDQDLRDSRQQAAQAFIHNSLYGPGTNRTTVNKFLSLANKRLPVKRAAVQFLNNAWGIQKKQNAKRFKRRWMVRKMKTKK Predict reactive species\nFull Name: nucleolar protein 7, 27kDa\nCalculated Molecular Weight: 257 aa, 29 kDa\nObserved Molecular Weight: 38 kDa\nGenBank Accession Number: BC023517\nGene Symbol: NOL7\nGene ID (NCBI): 51406\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9UMY1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887739883689,"sku":"18424-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-18424-1-ap","provider":"Iright","version":"1.0","type":"link"}