{"product_id":"proteintech-18475-1-ap","title":"Proteintech, 18475-1-AP, ID1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ID1 (18475-1-AP) by Proteintech is a Polyclonal antibody targeting ID1 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n18475-1-AP targets ID1 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells\nPositive IHC detected in: human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: PC-3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:300-1:1200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nID (inhibitor of DNA binding) proteins contain a helix-loop-helix (HLH) motif and regulate tissue-specific transcription within several cell lineages. They do not bind DNA directly, but inhibit lineage commitment by binding basic helix-loop-helix (bHLH) transcription factors through their HLH motif. ID1 proteins lack a basic DNA-binding domain but are able to form heterodimers with other HLH proteins, thereby inhibiting DNA binding. ID proteins contribute to cell growth, senescence, differentiation, and angiogenesis. Inhibitor of differentiation or DNA binding-1 (ID1) interacts with the transactivation domain of p65 (p65TAD) both in vitro and in vivo. The molecular weight of ID1 is about 20 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, rabbit\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag13359 Product name: Recombinant human ID1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-155 aa of BC000613 Sequence: MKVASGSTATAAAGPSCALKAGKTASGAGEVVRCLSEQSVAISRCAGGAGARLPALLDEQQVNVLLYDMNGCYSRLKELVPTLPQNRKVSKVEILQHVIDYIRDLQLELNSESEVGTPGGRGLPVRAPLSTLNGEISALTAEAACVPADDRILCR Predict reactive species\nFull Name: inhibitor of DNA binding 1, dominant negative helix-loop-helix protein\nCalculated Molecular Weight: 16 kDa\nObserved Molecular Weight: 20 kDa\nGenBank Accession Number: BC000613\nGene Symbol: ID1\nGene ID (NCBI): 3397\nRRID: AB_2248812\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P41134\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868879147177,"sku":"18475-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-18475-1-ap","provider":"Iright","version":"1.0","type":"link"}