{"product_id":"proteintech-18590-1-ap","title":"Proteintech, 18590-1-AP, iASPP Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe iASPP (18590-1-AP) by Proteintech is a Polyclonal antibody targeting iASPP in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n18590-1-AP targets iASPP in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: NIH\/3T3 cells, PC-3 cells,  MCF-7 cells,  Apoptosised HeLa cells,  C6 cells\nPositive IP detected in: PC-3 cells\nPositive IHC detected in: human breast cancer tissue, human cervical squamous cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:400-1:1600\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:10-1:100\n\u003cb\u003eBackground Information\u003c\/b\u003e\nInhibitor of apoptosis-stimulating protein of p53 (iASPP), encoded by PPP1R13L gene, is often overexpressed in human cancers. The ASPP family includes three members, namely ASPP1, ASPP2, and iASPP, which are specific regulators of p53-, p63-, and p73-mediated apoptosis. ASPP1 and ASPP2 enhance the apoptotic function of p53, whereas iASPP specifically inhibits p53-mediated apoptosis. Overexpression of iASPP is associated with resistance to cisplatin-induced apoptosis and rediation therapy. iASPP plays a pivotal role in regulating cancer cell proliferation and tumor progression. This antibody could both recognize unphosphorylated and phosphorylated iASPP.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag13273 Product name: Recombinant human PPP1R13L protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 481-829 aa of BC064913 Sequence: EGPVARPLSPTRLQPALPPEAQSVPELEEVARVLAEIPRPLKRRGSMEQAPAVALPPTHKKQYQQIISRLFHRHGGPGPGGPEPELSPITEGSEARAGPPAPAPPAPIPPPAPSQSSPPEQPQSMEMRSVLRKAGSPRKARRARLNPLVLLLDAALTGELEVVQQAVKEMNDPSQPNEEGITALHNAICGANYSIVDFLITAGANVNSPDSHGWTPLHCAASCNDTVICMALVQHGAAIFATTLSDGATAFEKCDPYREGYADCATYLADVEQSMGLMNSGAVYALWDYSAEFGDELSFREGESVTVLRRDGPEETDWWWAALHGQEGYVPRNYFGLFPRVKPQRSKV Predict reactive species\nFull Name: protein phosphatase 1, regulatory (inhibitor) subunit 13 like\nCalculated Molecular Weight: 89 kDa\nObserved Molecular Weight: 110 kDa\nGenBank Accession Number: BC064913\nGene Symbol: PPP1R13L\nGene ID (NCBI): 10848\nRRID: AB_2168573\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8WUF5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868982923433,"sku":"18590-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-18590-1-ap","provider":"Iright","version":"1.0","type":"link"}