{"product_id":"proteintech-18658-1-ap","title":"Proteintech, 18658-1-AP, NR5A1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NR5A1 (18658-1-AP) by Proteintech is a Polyclonal antibody targeting NR5A1 in WB, IHC, FC (Intra), IP, ELISA applications with reactivity to human, mouse, rat samples\n18658-1-AP targets NR5A1 in WB, IHC, IF, FC (Intra), IP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse ovary tissue, rat ovary tissue\nPositive IP detected in: A2780 cells\nPositive IHC detected in: human ovary tissue, human liver tissue,  rat testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive FC (Intra) detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSteroidogenic factor-1 (SF-1,STF-1), also known as NR5A1, regulates multiple genes involved in the adrenal and gonadal development and in the biosynthesis of a variety of hormones, including adrenal and gonadal steroids, anti-Mullerian hormone (AMH), and gonadotropins. SF-1 belongs to the fushi tarazu factor-1 (FTZ-F1) subfamily of orphan nuclear receptors. Initially identified as a tissue-specific transcriptional regulator of cytochrome P450 steroid hydroxylases, research studies of both global and tissue-specific knockout mice have demonstrated that SF-1 is required for the development of adrenal glands, gonads, ventromedial hypothalamus, and for the proper \n\nfunctioning of pituitary gonadotropes. Indeed, humans with mutations that render SF-1 transcriptionally inactive can present with testicular failure, ovarian failure, and adrenal insufficiency. Furthermore, dysregulation of SF-1 has been linked to diseases such as endometriosis and adrenocortical carcinoma.Like other nuclear hormone receptors, SF-1 has a modular domain structure composed of an N-terminal zinc finger DNA-binding domain, a ligand-binding domain, a C-terminal AF-2 activation domain, \n\nand a hinge region with AF-1-like activation activity. SF-1 also contains a fushi tarazu factor 1 box, which functions as an accessory DNA binding domain. SF-1 is \n\nprimarily phosphorylated at Ser203, which is thought to enhance its transcriptional activity by promoting complex formation with transcriptional cofactors. In addition \n\nto phosphorylation at Ser203, SF-1 is subject to SUMO conjugation and acetylation at ε-amino groups of target lysine residues. Whereas SUMOylation represses SF-1 \n\nfunction, acetylation enhances its transcriptional activity.In the adult ovary, SF-1 localizes to theca\/interstitial cells.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, pig, goat, camel, ondatra zibethicus\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag13252 Product name: Recombinant human NR5A1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-349 aa of BC032501 Sequence: MDYSYDEDLDELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNNKHYTCTESQSCKIDKTQRKRCPFCRFQKCLTVGMRLEAVRADRMRGGRNKFGPMYKRDRALKQQKKAQIRANGFKLETGPPMGVPPPPPPAPDYVLPPSLHGPEPKGLAAGPPAGPLGDFGAPALPMAVPGAHGPLAGYLYPAFPGRAIKSEYPEPYASPPQPGLPYGYPEPFSGGPNVPELILQLLQLEPDEDQVRARILGCLQEPTKSRPDQPAAFGLLCRMADQTFISIVDWARRCMVFKELEVADQMTLLQNCWSELLVFDHIYRQVQHGKEGSILLVTGQEVELTTVATQAGSLLHSLVL Predict reactive species\nFull Name: nuclear receptor subfamily 5, group A, member 1\nCalculated Molecular Weight: 52 kDa\nObserved Molecular Weight: 52 kDa\nGenBank Accession Number: BC032501\nGene Symbol: NR5A1\nGene ID (NCBI): 2516\nRRID: AB_10596916\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q13285\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868874264745,"sku":"18658-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-18658-1-ap","provider":"Iright","version":"1.0","type":"link"}