{"product_id":"proteintech-18894-1-ap","title":"Proteintech, 18894-1-AP, HOXB9 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe HOXB9 (18894-1-AP) by Proteintech is a Polyclonal antibody targeting HOXB9 in WB, ELISA applications with reactivity to human, mouse, rat samples\n18894-1-AP targets HOXB9 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: K-562 cells, HT-29 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHOXB9 is a member of the Homeobox (HOX) gene family, which plays a crucial role in embryonic development and is involved in the regulation of gene expression during this process. In addition to its role in embryogenesis, HOXB9 has been implicated in various cancers, including breast and prostate cancer. It is overexpressed in breast cancer tissue and is regulated by estrogen, playing a critical role in angiogenesis. HOXB9 overexpression has been shown to stimulate three-dimensional colony formation in soft-agar assays, indicating its role in tumorigenesis. Furthermore, HOXB9 binds to the promoters of various tumor growth and angiogenic factors, regulating their expression, and its homeodomain plays a crucial role in transcriptional regulation and tumorigenesis.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag13502 Product name: Recombinant human HOXB9 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-202 aa of BC015565 Sequence: MSISGTLSSYYVDSIISHESEDAPPAKFPSGQYASSRQPGHAEHLEFPSCSFQPKAPVFGASWAPLSPHASGSLPSVYHPYIQPQGVPPAESRYLRTWLEPAPRGEAAPGQGQAAVKAEPLLGAPGELLKQGTPEYSLETSAGREAVLSNQRPGYGDNKICEGSEDKERPDQTNPSANWLHARSSRKKRCPYTKYQTLELEK Predict reactive species\nFull Name: homeobox B9\nCalculated Molecular Weight: 250 aa, 28 kDa\nObserved Molecular Weight: 30-32 kDa\nGenBank Accession Number: BC015565\nGene Symbol: HOXB9\nGene ID (NCBI): 3219\nRRID: AB_3085571\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P17482\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869694841001,"sku":"18894-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-18894-1-ap","provider":"Iright","version":"1.0","type":"link"}