{"product_id":"proteintech-18898-1-ap","title":"Proteintech, 18898-1-AP, NEURL Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NEURL (18898-1-AP) by Proteintech is a Polyclonal antibody targeting NEURL in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n18898-1-AP targets NEURL in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: MCF-7 cells, mouse brain tissue,  Y79 cells,  SH-SY5Y cells,  rat brain tissue\nPositive IP detected in: mouse brain tissue\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNEURL(Neuralized-like protein 1A) is also named as NEURL1, NEURL1A, RNF67.Neurl1 is a RING-dependent E3 ubiquitin ligase that can regulate Notch signaling in mammals and it expression promotes lysosomal degradation of Jagged1 in cells and blocks signaling from Jagged1-expressing cells to neighboring Notch-expressing cells. Neurl-dependent turnover of Jagged1 and inhibition of Notch signaling depends upon N-terminal myristoylation and plasma membrane localization of Neurl1(PMID:18077452).This antibody is specific to NEURL.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag13531 Product name: Recombinant human NEURL protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-345 aa of BC026336 Sequence: MGNNFSSIPSLPRGNPSRAPRGHPQNLKDSIGGPFPVTSHRCHHKQKHCPAVLPSGGLPAAPLLFHPHTKGSQILMDLSHKAVKRQASFCNAITFSNRPVLIYEQVRLKITKKQCCWSGALRLGFTSKDPSRIHPDSLPKYACPDLVSQSGFWAKALPEEFANEGNIIAFWVDKKGRVFHRINDSAVMLFFSGVRTADPLWALVDVYGLTRGVQLLDSELVLPDCLRPRSFTALRRPSLRREADDARLSVSLCDLNVPGADGDEAAPAASCPIPQNSLNSQHSRALPAQLDGDLRFHALRAGAHVRILDEQTVARVEHGRDERALVFTSRPVRVAETIFVKVTRS Predict reactive species\nFull Name: neuralized homolog (Drosophila)\nCalculated Molecular Weight: 59 kDa\nObserved Molecular Weight: 60-62 kDa\nGenBank Accession Number: BC026336\nGene Symbol: NEURL\nGene ID (NCBI): 9148\nRRID: AB_10642557\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O76050\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869718237353,"sku":"18898-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-18898-1-ap","provider":"Iright","version":"1.0","type":"link"}