{"product_id":"proteintech-18966-1-ap","title":"Proteintech, 18966-1-AP, KIR2DL3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe KIR2DL3 (18966-1-AP) by Proteintech is a Polyclonal antibody targeting KIR2DL3 in WB, ELISA applications with reactivity to human samples\n18966-1-AP targets KIR2DL3 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human liver tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nKiller cell immunoglobulin-like receptors (KIRs) are a diverse family of inhibitory and activating receptors expressed on NK cells and a subset of T cells (PMID: 11861603). These polymorphic receptors interact with specific motifs on HLA class I molecules, modulate NK cytolytic activity and are encoded by genes located on chromosome 19q13.4 (PMID: 17069649). KIR2DL3, also known as CD158B2 or NKAT2, is an inhibitory receptor that is specific for HLA-C alleles (HLA-Cw1, HLA-Cw3 and HLA-Cw7) (PMID: 10196125). It is a 341-amino acid transmembrane glycoprotein consisting of an extracellular region containing two C2-type Ig-like domains, a 19-amino acid hydrophobic transmembrane region, and a long cytoplasmic tail with two immunoreceptor tyrosine-based inhibitory motifs (ITIMs). KIR2DL3 inhibits the cytolytic activity of NK cells thus preventing cell lysis (PMID: 7724594).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag5163 Product name: Recombinant human KIR2DL3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 20-247 aa of BC032422 Sequence: WPHEGVHRKPSLLAHPGPLVKSEETVILQCWSDVRFQHFLLHREGKFKDTLHLIGEHHDGVSKANFSIGPMMQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVTLSCSSRSSYDMYHLSREGEAHERRFSAGPKVNGTFQADFPLGPATHGGTYRCFGSFRDSPYEWSNSSDPLLVSVTGNPSNSWLSPTEPSSETGNPRHLHVL Predict reactive species\nFull Name: killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 3\nCalculated Molecular Weight: 341 aa, 38 kDa\nObserved Molecular Weight: 58 kDa\nGenBank Accession Number: BC032422\nGene Symbol: KIR2DL3\nGene ID (NCBI): 3804\nRRID: AB_2130398\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P43628\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887696728233,"sku":"18966-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-18966-1-ap","provider":"Iright","version":"1.0","type":"link"}