{"product_id":"proteintech-19050-1-ap","title":"Proteintech, 19050-1-AP, SGMS1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SGMS1 (19050-1-AP) by Proteintech is a Polyclonal antibody targeting SGMS1 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples\n19050-1-AP targets SGMS1 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HT-29 cells, human heart tissue\nPositive IP detected in: mouse heart tissue\nPositive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSphingomyelin synthase (SMS), with two isoforms, SMS1 (SGMS1) and SMS2, is a key enzyme involved in the generation and development of SM. SMS can participate in inflammation, atherosclerosis, proliferation, apoptosis, differentiation and other functions(PMID:30535436). SMS1 is frequently downregulated in various solid cancers, more particularly in melanoma(PMID:31114500). SGMS1 has two isoforms.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag5246 Product name: Recombinant human SGMS1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-145 aa of BC042899 Sequence: MKEVVYWSPKKVADWLLENAMPEYCEPLEHFTGQDLINLTQEDFKKPPLCRVSSDNGQRLLDMIETLKMEHHLEAHKNGHANGHLNIGVDIPTPDGSFSIKIKPNGMPNGYRKEMIKIPMPELERSQYPMEWGKTFLAFLYALSC Predict reactive species\nFull Name: sphingomyelin synthase 1\nCalculated Molecular Weight: 49 kDa\nObserved Molecular Weight: 25 kDa, 49 kDa\nGenBank Accession Number: BC042899\nGene Symbol: SGMS1\nGene ID (NCBI): 259230\nRRID: AB_2188417\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q86VZ5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868903821481,"sku":"19050-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-19050-1-ap","provider":"Iright","version":"1.0","type":"link"}