{"product_id":"proteintech-19117-1-ap","title":"Proteintech, 19117-1-AP, CDK6 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CDK6 (19117-1-AP) by Proteintech is a Polyclonal antibody targeting CDK6 in WB, IHC, IF\/ICC, FC (Intra), IP, ELISA applications with reactivity to human, mouse, rat samples\n19117-1-AP targets CDK6 in WB, IHC, IF\/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HEK-293 cells,  Jurkat cells,  HepG2 cells,  K-562 cells,  HSC-T6 cells\nPositive IP detected in: Jurkat cells\nPositive IHC detected in: human lung cancer tissue, human gliomas tissue,  human endometrial cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\nPositive FC (Intra) detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:12000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCDK6(Cyclin-dependent kinase 6) is involved in initiation and maintenance of cell cycle exit during cell differentiation and it prevents cell proliferation and regulates negatively cell differentiation, but is required for the proliferation of specific cell types.The molecular weight of CDK6 is 36-40 KDa (PMID: 23563707, 8114739).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag5600 Product name: Recombinant human CDK6 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-326 aa of BC027989 Sequence: MEKDGLCRADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTGEEGMPLSTIREVAVLRHLETFEHPNVVRLFDVCTVSRTDRETKLTLVFEHVDQDLTTYLDKVPEPGVPTETIKDMMFQLLRGLDFLHSHRVVHRDLKPQNILVTSSGQIKLADFGLARIYSFQMALTSVVVTLWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRKPLFRGSSDVDQLGKILDVIGLPGEEDWPRDVALPRQAFHSKSAQPIEKFVTDIDELGKDLLLKCLTFNPAKRISAYSALSHPYFQDLERCKENLDSHLPPSQNTSELNTA Predict reactive species\nFull Name: cyclin-dependent kinase 6\nCalculated Molecular Weight: 326 aa, 36 kDa\nObserved Molecular Weight: 36-40 kDa\nGenBank Accession Number: BC027989\nGene Symbol: CDK6\nGene ID (NCBI): 1021\nRRID: AB_10640575\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q00534\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868878557353,"sku":"19117-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-19117-1-ap","provider":"Iright","version":"1.0","type":"link"}