{"product_id":"proteintech-19157-1-ap","title":"Proteintech, 19157-1-AP, Tie-2\/CD202b Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Tie-2\/CD202b (19157-1-AP) by Proteintech is a Polyclonal antibody targeting Tie-2\/CD202b in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples\n19157-1-AP targets Tie-2\/CD202b in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse lung tissue, mouse liver tissue,  Rat lung tissue\nPositive IP detected in: mouse lung tissue\nPositive IHC detected in: human placenta tissue, mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTie2 (also known as TEK) is a tyrosine-protein kinase expressed almost exclusively on endothelial cells. It contains two immunoglobulin-like domains, three epidermal growth factor (EGF)--like domains and three fibronectin type III repeats. Tie2 acts as a cell-surface receptor for ANGPT1, ANGPT2, and ANGPT4 and regulates angiogenesis, endothelial cell survival, proliferation, migration, adhesion and cell spreading, reorganization of the actin cytoskeleton, but also maintenance of vascular quiescence. Mutations in the gene Tie2 are associated with inherited venous malformations of the skin and mucous membranes. Human Tie2 has a calculated molecular weight of 126 kDa. As a result of glycosylation, the apparent molecular mass of Tie2 is approximately 140-160 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag13523 Product name: Recombinant human TEK protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 779-1124 aa of BC035514 Sequence: RRMAQAFQNVREEPAVQFNSGTLALNRKVKNNPDPTIYPVLDWNDIKFQDVIGEGNFGQVLKARIKKDGLRMDAAIKRMKEYASKDDHRDFAGELEVLCKLGHHPNIINLLGACEHRGYLYLAIEYAPHGNLLDFLRKSRVLETDPAFAIANSTASTLSSHHLLHFAADVARGMDYLSQKQFIHRDLAARNILVGENYVAKIADFGLSRGQEVYVKKTMGRLPVRWMAIESLNYSVYTTNSDVWSYGVLLWEIVSLGGTPYCGMTCAELYEKLPQGYRLEKPLNCDDEVYDLMRQCWREKPYERPSFAQILVSLNRMLEERKTYVNTTLYEKFTYAGIDCSAEEAA Predict reactive species\nFull Name: TEK tyrosine kinase, endothelial\nCalculated Molecular Weight: 1124 aa, 126 kDa\nObserved Molecular Weight: 140 kDa\nGenBank Accession Number: BC035514\nGene Symbol: Tie2\nGene ID (NCBI): 7010\nRRID: AB_10644297\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q02763\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868860993705,"sku":"19157-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-19157-1-ap","provider":"Iright","version":"1.0","type":"link"}