{"product_id":"proteintech-19254-1-ap","title":"Proteintech, 19254-1-AP, COSMC Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe COSMC (19254-1-AP) by Proteintech is a Polyclonal antibody targeting COSMC in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n19254-1-AP targets COSMC in WB, IF, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HepG2 cells,  Caco-2 cells\nPositive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCOSMC (C1GALT1C1) is a molecular chaperone required for expression of active T-synthase (CIGALT1) which catalyzes the synthesis of Tn antigen. Tn antigens are cancer-associated glycans and play an important role in tumor progression. Dysfunctional COSMC is able to convert a wild type protein into a tumor-specific antigen affecting tumor cell biology. COSMC overexpression had been observed in various cancers. COSMC mutations have been observed in an autoimmune disease Tn syndrome.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag6899 Product name: Recombinant human C1GALT1C1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-318 aa of BC050441 Sequence: MLSESSSFLKGVMLGSIFCALITMLGHIRIGHGNRMHHHEHHHLQAPNKEDILKISEDERMELSKSFRVYCIILVKPKDVSLWAAVKETWTKHCDKAEFFSSENVKVFESINMDTNDMWLMMRKAYKYAFDKYRDQYNWFFLARPTTFAIIENLKYFLLKKDPSQPFYLGHTIKSGDLEYVGMEGGIVLSVESMKRLNSLLNIPEKCPEQGGMIWKISEDKQLAVCLKYAGVFAENAEDADGKDVFNTKSVGLSIKEAMTYHPNQVVEGCCSDMAVTFNGLTPNQMHVMMYGVYRLRAFGHIFNDALVFLPPNGSDND Predict reactive species\nFull Name: C1GALT1-specific chaperone 1\nCalculated Molecular Weight: 36 kDa\nObserved Molecular Weight: 36-37 kDa\nGenBank Accession Number: BC050441\nGene Symbol: COSMC\nGene ID (NCBI): 29071\nRRID: AB_10638003\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96EU7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868964311209,"sku":"19254-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-19254-1-ap","provider":"Iright","version":"1.0","type":"link"}