{"product_id":"proteintech-19363-1-ap","title":"Proteintech, 19363-1-AP, SLC25A20 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SLC25A20 (19363-1-AP) by Proteintech is a Polyclonal antibody targeting SLC25A20 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n19363-1-AP targets SLC25A20 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Saos-2 cells, mouse heart tissue,  human testis tissue,  mouse skeletal muscle tissue,  mouse testis tissue,  rat testis tissue\nPositive IHC detected in: mouse heart tissue, human heart tissue,  human hepatocirrhosis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: Hela cells,  MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:10-1:100\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag6896 Product name: Recombinant human SLC25A20 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 96-209 aa of BC001689 Sequence: GKKLQQKHPEDVLSYPQLFAAGMLSGVFTTGIMTPGERIKCLLQIQASSGESKYTGTLDCAKKLYQEFGIRGIYKGTVLTLMRDVPASGMYFMTYEWLKNIFTPEGKRVSELSA Predict reactive species\nFull Name: solute carrier family 25 (carnitine\/acylcarnitine translocase), member 20\nCalculated Molecular Weight: 33 kDa\nObserved Molecular Weight: 33 kDa\nGenBank Accession Number: BC001689\nGene Symbol: SLC25A20\nGene ID (NCBI): 788\nRRID: AB_10642001\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O43772\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868921155753,"sku":"19363-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-19363-1-ap","provider":"Iright","version":"1.0","type":"link"}