{"product_id":"proteintech-19422-1-ap","title":"Proteintech, 19422-1-AP, FAM103A1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe FAM103A1 (19422-1-AP) by Proteintech is a Polyclonal antibody targeting FAM103A1 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n19422-1-AP targets FAM103A1 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells,  MCF-7 cells,  PC-3 cells\nPositive IHC detected in: mouse lung tissue, human oesophagus cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFAM103A1, also named as RNMT-activating mini protein, is a 118 amino acid protein, which belongs to the RAM family. FAM103A1 as a component of mRNA cap binding complex localizes in the nucleus. FAM103A1 is required for efficient mRNA cap methylation and regulates RNMT expression by a post-transcriptional stabilizing mechanism.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag13749 Product name: Recombinant human FAM103A1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-118 aa of BC003627 Sequence: MTDTAEAVPKFEEMFASRFTENDKEYQEYLKRPPESPPIVEEWNSRAGGNQRNRGNRLQDNRQFRGRDNRWGWPSDNRSNQWHGRSWGNNYPQHRQEPYYPQQYGHYGYNQRPPYGYY Predict reactive species\nFull Name: family with sequence similarity 103, member A1\nCalculated Molecular Weight: 118 aa, 14 kDa\nObserved Molecular Weight: 14 kDa\nGenBank Accession Number: BC003627\nGene Symbol: FAM103A1\nGene ID (NCBI): 83640\nRRID: AB_2878578\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9BTL3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869680652457,"sku":"19422-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-19422-1-ap","provider":"Iright","version":"1.0","type":"link"}