{"product_id":"proteintech-19428-1-ap","title":"Proteintech, 19428-1-AP, SEZ6L2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SEZ6L2 (19428-1-AP) by Proteintech is a Polyclonal antibody targeting SEZ6L2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n19428-1-AP targets SEZ6L2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, rat brain tissue\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSeizure 6-like protein 2 (SEZ6L2) is a type 1 transmembrane protein predominantly expressed in the brain. It belongs to the seizure-related gene 6 (SEZ6) family, which contains SEZ6, SEZ6L and SEZ6L2. SEZ6 family members have been shown to influence synapse numbers and dendritic morphology and are linked to various neurological and psychiatric disorders (PMID: 33936031). SEZ6L2 is a part of the AMPA receptor and acts as a scaffolding protein to link GluR1 to adducin (PMID: 29032200). Overexpression of SEZ6L2 has been reported in a variety of cancers, including lung cancer, hepatocellular carcinoma, thyroid carcinoma, cholangiocarcinoma (PMID: 16863507; 35117286; 35284305; 32148567). SEZ6L2 can be glycosylated and the apparent molecular weight can be raised to 150-170 kDa (PMID: 26698217; 24272587).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag13760 Product name: Recombinant human SEZ6L2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 280-626 aa of BC000567 Sequence: RVSLDEDNDRLMVRSGGSPLSPVIYDSDMDDVPERGLISDAQSLYVELLSETPANPLLLSLRFEAFEEDRCFAPFLAHGNVTTTDPEYRPGALATFSCLPGYALEPPGPPNAIECVDPTEPHWNDTEPACKAMCGGELSEPAGVVLSPDWPQSYSPGQDCVWGVHVQEEKRILLQVEILNVREGDMLTLFDGDGPSARVLAQLRGPQPRRRLLSSGPDLTLQFQAPPGPPNPGLGQGFVLHFKEVPRNDTCPELPPPEWGWRTASHGDLIRGTVLTYQCEPGYELLGSDILTCQWDLSWSAAPPACQKIMTCADPGEIANGHRTASDAGFPVGSHVQYRCLPGYSLE Predict reactive species\nFull Name: seizure related 6 homolog (mouse)-like 2\nCalculated Molecular Weight: 910 aa, 98 kDa\nObserved Molecular Weight: 150 kDa\nGenBank Accession Number: BC000567\nGene Symbol: SEZ6L2\nGene ID (NCBI): 26470\nRRID: AB_3085577\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q6UXD5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887798145193,"sku":"19428-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-19428-1-ap","provider":"Iright","version":"1.0","type":"link"}