{"product_id":"proteintech-19806-1-ap","title":"Proteintech, 19806-1-AP, TRIM35 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TRIM35 (19806-1-AP) by Proteintech is a Polyclonal antibody targeting TRIM35 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n19806-1-AP targets TRIM35 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: H9C2 cells, A431 cells,  HEK-293 cells\nPositive IHC detected in: human liver tissue, mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: U2OS cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTripartite motif 35 (TRIM35), also called hemopoietic lineage switch (Hls5), is a member of the RING finger, B box, coiled-coil (RBCC), or TRIM family E3 ligases expressed in a wide variety of hemopoietic cell types, including fetal liver progenitors. TRIM35 is reported to be a tumor suppressor gene and is expressed at low levels in several types of cancer (PMID: 34124276, 35081724). Western detected a band at 45-50 kDa possibly due to the high proline content.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag13584 Product name: Recombinant human TRIM35 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-206 aa of BC018337 Sequence: MERSPDVSPGPSRSFKEELLCAVCYDPFRDAVTLRCGHNFCRGCVSRCWEVQVSPTCPVCKDRASPADLRTNHTLNNLVEKLLREEAEGARWTSYRFSRVCRLHRGQLSLFCLEDKELLCCSCQADPRHQGHRVQPVKDTAHDFRVRSLIAEERRNFLPTHQWIVTKTRLQTSSPNLQSRRQGQVQEHGACTAGEGQGLLGHAALL Predict reactive species\nFull Name: tripartite motif-containing 35\nCalculated Molecular Weight: 57 kDa\nObserved Molecular Weight: 45~50 kDa\nGenBank Accession Number: BC018337\nGene Symbol: TRIM35\nGene ID (NCBI): 23087\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9UPQ4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887838449833,"sku":"19806-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-19806-1-ap","provider":"Iright","version":"1.0","type":"link"}