{"product_id":"proteintech-19811-1-ap","title":"Proteintech, 19811-1-AP, TLR4 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TLR4 (19811-1-AP) by Proteintech is a Polyclonal antibody targeting TLR4 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n19811-1-AP targets TLR4 in WB, IHC, IF, IP, CoIP, ChIP, ELISA, Microtiter plate binding assay applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: NIH\/3T3 cells, mouse liver tissue,  RAW 264.7 cells,  J774A.1 cells\nPositive IHC detected in: human placenta tissue, mouse brain tissue,  human liver cancer tissue,  human colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:100-1:400\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTLR4, also named CD284, belongs to the Toll-like receptor family. TLR4 interacts with LY96 and CD14 to mediate the innate immune response to bacterial lipopolysaccharide (LPS). TLR4 acts via MYD88, TIRAP, and TRAF6, leading to NF-kB activation, cytokine secretion, and the inflammatory response. Three alternatively spliced transcript variants that encode different protein isoforms have been described. The calculated molecular weights of the three TLR4 isoforms are 96, 91, and 73 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, pig, rabbit, canine, chicken, zebrafish, hamster, duck\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag13841 Product name: Recombinant human TLR4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 653-839 aa of BC117422 Sequence: KFYFHLMLLAGCIKYGRGENIYDAFVIYSSQDEDWVRNELVKNLEEGVPPFQLCLHYRDFIPGVAIAANIIHEGFHKSRKVIVVVSQHFIQSRWCIFEYEIAQTWQFLSSRAGIIFIVLQKVEKTLLRQQVELYRLLSRNTYLEWEDSVLGRHIFWRRLRKALLDGKSWNPEGTVGTGCNWQEATSI Predict reactive species\nFull Name: toll-like receptor 4\nCalculated Molecular Weight: 839 aa, 96 kDa\nObserved Molecular Weight: 90-110 kDa\nGenBank Accession Number: BC117422\nGene Symbol: TLR4\nGene ID (NCBI): 7099\nRRID: AB_10638446\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O00206\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868818657449,"sku":"19811-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-19811-1-ap","provider":"Iright","version":"1.0","type":"link"}