{"product_id":"proteintech-19825-1-ap","title":"Proteintech, 19825-1-AP, TMEM176B Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TMEM176B (19825-1-AP) by Proteintech is a Polyclonal antibody targeting TMEM176B in WB, ELISA applications with reactivity to human samples\n19825-1-AP targets TMEM176B in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells,  human placenta tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTMEM176B (also known as LR8) is a transmembrane protein belongs to the MS4A family of proteins. It may play a role in the process of maturation of dendritic cells. TMEM176B was first discovered in human lung fibroblasts and is associated with human small cell lung carcinoma. Studies suggest that TMEM176B might be involved in cancer and might serve as targets for antiangiogenic therapy of cancer patients (PMID: 24602018, 22244448). There are two isoforms produced by alternative splicing.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag13918 Product name: Recombinant human TMEM176B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 149-209 aa of BC004358 Sequence: SFIWQTEPFLYIDTVCDRSDPVFPTTGYRWMRRSQENQWQKEECRAYMQMLRKLFTAIRAL Predict reactive species\nFull Name: transmembrane protein 176B\nCalculated Molecular Weight: 270 aa, 29 kDa\nObserved Molecular Weight: 31 kDa, 23 kDa\nGenBank Accession Number: BC004358\nGene Symbol: TMEM176B\nGene ID (NCBI): 28959\nRRID: AB_10638313\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q3YBM2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869617180841,"sku":"19825-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-19825-1-ap","provider":"Iright","version":"1.0","type":"link"}