{"product_id":"proteintech-19836-1-ap","title":"Proteintech, 19836-1-AP, TWEAKR\/CD266 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TWEAKR\/CD266 (19836-1-AP) by Proteintech is a Polyclonal antibody targeting TWEAKR\/CD266 in IHC, ELISA applications with reactivity to human, mouse, rat samples\n19836-1-AP targets TWEAKR\/CD266 in IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: mouse heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTWEAKR (also known as CD266, FN14, TNFRSF12A) is a member of the TNF receptor superfamily which is activated by its ligand, the cytokine TWEAK (TNFSF12). TWEAKR is the smallest member of the TNFR superfamily. TweakR was first described as an FGF-inducible gene that played a role in fibroblast adhesion and migration. Subsequently, the induction of TweakR expression by other growth factors and\/or upon tissue injury was observed in multiple cell types, including hepatocytes, endothelial cells, adipocytes, and cardiomyocytes. (PMID: 23073510, PMID: 24409185)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag13823 Product name: Recombinant human TWEAKR protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 19-91 aa of BC002718 Sequence: LALLRSVAGEQAPGTAPCSRGSSWSADLDKCMDCASCRARPHSDFCLGCAAAPPAPFRLLWPILGGALSLTFV Predict reactive species\nFull Name: tumor necrosis factor receptor superfamily, member 12A\nCalculated Molecular Weight: 129 aa, 14 kDa\nGenBank Accession Number: BC002718\nGene Symbol: TWEAKR\nGene ID (NCBI): 51330\nRRID: AB_3669316\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NP84\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887911653545,"sku":"19836-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-19836-1-ap","provider":"Iright","version":"1.0","type":"link"}