{"product_id":"proteintech-19837-1-ap","title":"Proteintech, 19837-1-AP, STAG2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe STAG2 (19837-1-AP) by Proteintech is a Polyclonal antibody targeting STAG2 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n19837-1-AP targets STAG2 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells,  HeLa cells,  K-562 cells,  MCF-7 cells,  NIH\/3T3 cells\nPositive IP detected in: U-251 cells, MCF-7 cells\nPositive IHC detected in: human cervical cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HEK-293 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSTAG2, also named as SA2, is a component of cohesin complex, a complex required for the cohesion of sister chromatids after DNA replication. The cohesin complex may play a role in spindle pole assembly during mitosis. Mutations in STAG2 appear to be a first step in the transformation of a normal cell into a cancer cell.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag13825 Product name: Recombinant human STAG2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1047-1172 aa of BC001765 Sequence: SLLAGGDDDTMSVISGISSRGSTVRSKKSKPSTGKRKVVEGMQLSLTEESSSSDSMWLSREQTLHTPVMMQTPQLTSTIMREPKRLRPEDSFMSVYPMQTEHHQTPLDYNRRGTSLMEDDEEPIVE Predict reactive species\nFull Name: stromal antigen 2\nCalculated Molecular Weight: 1231 aa, 141 kDa\nObserved Molecular Weight: 130-141 kDa\nGenBank Accession Number: BC001765\nGene Symbol: STAG2\nGene ID (NCBI): 10735\nRRID: AB_10666847\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8N3U4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869772763305,"sku":"19837-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-19837-1-ap","provider":"Iright","version":"1.0","type":"link"}