{"product_id":"proteintech-19858-1-ap","title":"Proteintech, 19858-1-AP, Spermidine synthase Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Spermidine synthase (19858-1-AP) by Proteintech is a Polyclonal antibody targeting Spermidine synthase in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n19858-1-AP targets Spermidine synthase in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, LNCaP cells,  HepG2 cells,  PC-3 cells,  mouse liver tissue,  rat liver tissue,  RAW 264.7 cells,  mouse brain tissue\nPositive IP detected in: mouse liver tissue\nPositive IHC detected in: human kidney tissue, human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSpermidine synthase is an enzyme that catalyzes the transfer of the propylamine group from S-adenosylmethioninamine to putrescine in the biosynthesis of spermidine. The polyamines putrescine, spermine, and spermidine are ubiquitous polycationic mediators of cell growth and differentiation. Spermidine synthases catalyze the production of the linear triamine, spermidine, from putrescine. They utilize decarboxylated S-adenosylmethionine (dc-SAM), a universal cofactor of aminopropyltransferases, as a donor of the aminopropyl moiety (PMID:31134111).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag13936 Product name: Recombinant human SRM protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-302 aa of BC000309 Sequence: MEPGPDGPAASGPAAIREGWFRETCSLWPGQALSLQVEQLLHHRRSRYQDILVFRSKTYGNVLVLDGVIQCTERDEFSYQEMIANLPLCSHPNPRKVLIIGGGDGGVLREVVKHPSVESVVQCEIDEDVIQVSKKFLPGMAIGYSSSKLTLHVGDGFEFMKQNQDAFDVIITDSSDPMGPAESLFKESYYQLMKTALKEDGVLCCQGECQWLHLDLIKEMRQFCQSLFPVVAYAYCTIPTYPSGQIGFMLCSKNPSTNFQEPVQPLTQQQVAQMQLKYYNSDVHRAAFVLPEFARKALNDVS Predict reactive species\nFull Name: spermidine synthase\nCalculated Molecular Weight: 302 aa, 34 kDa\nObserved Molecular Weight: 34 kDa\nGenBank Accession Number: BC000309\nGene Symbol: Spermidine synthase\nGene ID (NCBI): 6723\nRRID: AB_10665555\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P19623\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868895236265,"sku":"19858-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-19858-1-ap","provider":"Iright","version":"1.0","type":"link"}