{"product_id":"proteintech-19886-1-ap","title":"Proteintech, 19886-1-AP, PHD2\/EGLN1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PHD2\/EGLN1 (19886-1-AP) by Proteintech is a Polyclonal antibody targeting PHD2\/EGLN1 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n19886-1-AP targets PHD2\/EGLN1 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: L02 cells, HCT 116 cells,  HEK-293 cells,  HEK-293T cells,  HepG2 cells\nPositive IP detected in: HEK-293 cells\nPositive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: A431 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:12000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nEGLN1(Egl nine homolog 1) is also named as HIF-PH2,HPH-2,PHD2.It is the most important isozyme under normoxia and, through regulating the stability of HIF1, involved in various hypoxia-influenced processes such as angiogenesis in retinal and cardiac functionality. EGLN1 plays a critical role in regulating HIF levels in EPO-producing cells in humans(PMID:16407130).Defects in EGLN1 are the cause of familial erythrocytosis type 3 (ECYT3).This antibody is specific to EGLN1.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag13706 Product name: Recombinant human EGLN1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 273-426 aa of BC005369 Sequence: MSSMDDLIRHCNGKLGSYKINGRTKAMVACYPGNGTGYVRHVDNPNGDGRCVTCIYYLNKDWDAKVSGGILRIFPEGKAQFADIEPKFDRLLFFWSDRRNPHEVQPAYATRYAITVWYFDADERARAKVKYLTGEKGVRVELNKPSDSVGKDVF Predict reactive species\nFull Name: egl nine homolog 1 (C. elegans)\nCalculated Molecular Weight: 426 aa, 46 kDa\nObserved Molecular Weight: 46 kDa\nGenBank Accession Number: BC005369\nGene Symbol: PHD2\/EGLN1\nGene ID (NCBI): 54583\nRRID: AB_10641986\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9GZT9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868882686121,"sku":"19886-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-19886-1-ap","provider":"Iright","version":"1.0","type":"link"}