{"product_id":"proteintech-19925-1-ap","title":"Proteintech, 19925-1-AP, TMEM175 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TMEM175 (19925-1-AP) by Proteintech is a Polyclonal antibody targeting TMEM175 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n19925-1-AP targets TMEM175 in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HEK-293 cells,  SH-SY5Y cells,  HepG2 cells\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTMEM175 has two repeats of 6-transmembrane-spanning segments and has no GYG K+ channel sequence signature-containing, pore-forming P loop. Lysosomes lacking TMEM175 exhibit no K+conductance, have a markedly depolarized ΔΨ and little sensitivity to changes in [K+], and have compromised luminal pH stability and abnormal fusion with autophagosomes during autophagy. TMEM175 comprises a K+ channel that underlies the molecular mechanism of lysosomal K+ permeability. It has two isoforms with MW 41-45 kDa and 54-60 kDa. For optimal WB detection with this antibody, we recommend avoiding boiling the sample after lysis.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, monkey\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag13890 Product name: Recombinant human TMEM175 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 222-313 aa of BC005158 Sequence: YVSKVTGWCRDRLLGHREPSAHPVEVFSFDLHEPLSKERVEAFSDGVYAIVATLLILDICEDNVPDPKDVKERFSGSLVAALSATGPRFLAY Predict reactive species\nFull Name: transmembrane protein 175\nCalculated Molecular Weight: 504 aa, 56 kDa\nObserved Molecular Weight: 41-45 kDa, 54-60 kDa\nGenBank Accession Number: BC005158\nGene Symbol: TMEM175\nGene ID (NCBI): 84286\nRRID: AB_10666166\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9BSA9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868815872169,"sku":"19925-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-19925-1-ap","provider":"Iright","version":"1.0","type":"link"}