{"product_id":"proteintech-20119-1-ap","title":"Proteintech, 20119-1-AP, ZCCHC11 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ZCCHC11 (20119-1-AP) by Proteintech is a Polyclonal antibody targeting ZCCHC11 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human samples\n20119-1-AP targets ZCCHC11 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells,  human brain tissue\nPositive IHC detected in: human brain tissue,  human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: Hela cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:10-1:100\n\u003cb\u003eBackground Information\u003c\/b\u003e\nZCCHC11, also named as KIAA0191 and TUT4, is an uridylyltransferase that acts as a suppressor of microRNA (miRNA) biogenesis by specifically mediating the terminal uridylation of some miRNAs. ZCCHC11 catalyzes the 3' uridylation of precursor let-7 (pre-let-7), a miRNA precursor. Uridylated pre-let-7 miRNAs fail to be processed by Dicer and undergo degradation. Degradation of pre-let-7 contributes to the maintenance of embryonic stem (ES) cells and is required for ES cells to maintain pluripotency. ZCCHC11 can't bind RNA by itself, recruited to pre-let-7 miRNAs via its interaction with LIN28 and LIN28B. Also catalyzes the 3' uridylation of miR-26A, a miRNA that represses IL6 transcript, leading to abrogate IL6 transcript repression and promote cytokine expression. ZCCHC11 may also suppress Toll-like receptor-induced NF-kappa-B activity via binding to T2BP.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag13661 Product name: Recombinant human ZCCHC11 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-275 aa of BC048301 Sequence: MEESKTLKSENHEPKKNVICEESKAVQVIGNQTLKARNDKSVKEIENSSPNRNSSKKNKQNDICIEKTEVKSCKVNAANLPGPKDLGLVLRDQSHCKAKKFPNSPVKAEKATISQAKSEKATSLQAIAEKSPKSPNSVKAEKASSYQMKSEKVPSSPAEAEKGPSLLLKDMRQKTELQQIGKKIPSSFTSVDKVNIEAVGGEKCALQNSPRSQKQQTCTDNTGDSDDSASGIEDVSDDLSKMKNDESNKENSSEMDYLENATVIDESALTPEQRL Predict reactive species\nFull Name: zinc finger, CCHC domain containing 11\nCalculated Molecular Weight: 185 kDa\nObserved Molecular Weight: 185 kDa\nGenBank Accession Number: BC048301\nGene Symbol: ZCCHC11\nGene ID (NCBI): 23318\nRRID: AB_10664927\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q5TAX3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869794783401,"sku":"20119-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-20119-1-ap","provider":"Iright","version":"1.0","type":"link"}