{"product_id":"proteintech-20124-1-ap","title":"Proteintech, 20124-1-AP, PP4R4 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PP4R4 (20124-1-AP) by Proteintech is a Polyclonal antibody targeting PP4R4 in WB, ELISA applications with reactivity to human, mouse, rat samples\n20124-1-AP targets PP4R4 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: rat brain tissue, rat testis tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPP4R4 (also known as SMEK1) is a regulatory subunit of protein phosphatase 4 (PP4), a serine\/threonine phosphatase complex crucial for diverse cellular processes. It plays a key role in directing PP4's activity and substrate specificity, particularly in the DNA damage response, cell cycle progression, and centrosome maturation. Studies highlight its involvement in critical pathways such as ATM\/ATR signaling for DNA repair and its regulatory function in cell division. Dysregulation of PP4R4 is implicated in genomic instability and is associated with various diseases, including cancer.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag13868 Product name: Recombinant human PPP4R4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-98 aa of BC002650 Sequence: MHPPPPAAAMDFSQNSLFGYMEDLQELTIIERPVRRSLKTPEEIERLTVDEDLSDIERAVYLLSAGQDVQGTSVIANLPFLMRQNPTETLRRVLPKVR Predict reactive species\nFull Name: protein phosphatase 4, regulatory subunit 4\nCalculated Molecular Weight: 417 aa, 47 kDa\nObserved Molecular Weight: 90-100 kDa\nGenBank Accession Number: BC002650\nGene Symbol: PP4R4\nGene ID (NCBI): 57718\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q6NUP7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887769243817,"sku":"20124-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-20124-1-ap","provider":"Iright","version":"1.0","type":"link"}