{"product_id":"proteintech-20168-1-ap","title":"Proteintech, 20168-1-AP, SLC25A23 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SLC25A23 (20168-1-AP) by Proteintech is a Polyclonal antibody targeting SLC25A23 in WB, ELISA applications with reactivity to human, mouse, rat samples\n20168-1-AP targets SLC25A23 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse pancreas tissue,  mouse skeletal muscle tissue,  mouse testis tissue,  SH-SY5Y cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSLC25A23 gene encodes a 468 amino acids polypeptide, named SCaMC-3, with a bipartite structure typical of calcium-binding mitochondrial solute carrier (CaMSC) proteins. The amino-terminal portion harbors three canonical EF-hand calcium-binding domains while the carboxyl-terminal portion of SCaMC-3 has the characteristic features of the mitochondrial solute carrier (MSC) superfamily. Northern blot analysis reveals the presence of the transcript in brain, heart, skeletal muscle, liver and small intestine. The SLC25A23 gene undergoes alternative splicing suggesting a modular nature of the encoded product. Three out of four putative protein isoforms lack a significant portion of the third mitochondrial carrier signature. The most common SCaMC-3 isoform shows a mitochondrial subcellular localization when transfected in HeLa cells and is able to bind calcium by Ca2+ dependent mobility shift assays.(PMID: 15716113)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag13987 Product name: Recombinant human SLC25A23 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-189 aa of BC001656 Sequence: MRGSPGDAERRQRWGRLFEELDSNKDGRVDVHELRQGLARLGGGNPDPGAQQGISSEGDADPDGGLDLEEFSRYLQEREQRLLLMFHSLDRNQDGHIDVSEIQQSFRALGISISLEQAEKILHSMDRDGTMTIDWQEWRDHFLLHSLENVEDVLYFWKHSTLSSAGFSAWIKDSTAEQNRSKTTVLARR Predict reactive species\nFull Name: solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 23\nCalculated Molecular Weight: 468 aa, 52 kDa\nObserved Molecular Weight: 49-54 kDa\nGenBank Accession Number: BC001656\nGene Symbol: SLC25A23\nGene ID (NCBI): 79085\nRRID: AB_10638608\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9BV35\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869765062825,"sku":"20168-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-20168-1-ap","provider":"Iright","version":"1.0","type":"link"}