{"product_id":"proteintech-20175-1-ap","title":"Proteintech, 20175-1-AP, NCOA5 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NCOA5 (20175-1-AP) by Proteintech is a Polyclonal antibody targeting NCOA5 in WB, IHC, IF\/ICC, FC (Intra), IP, ELISA applications with reactivity to human, mouse samples\n20175-1-AP targets NCOA5 in WB, IHC, IF\/ICC, FC (Intra), IP, ChIP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, HeLa cells\nPositive IP detected in: HEK-293 cells\nPositive IHC detected in: human stomach tissue, mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: A431 cells\nPositive FC (Intra) detected in: HEK-293 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:200-1:800\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNuclear receptor coactivator 5 (NCOA5), also known as coactivator independent of AF-2 (CIA), possesses both repressor and activator functions (PMID: 11113208). It can interact with Estrogen Receptor (ER) alpha and ER beta in a ligand-dependent manner. NCOA5 has been shown to regulate the ER alpha-mediated transcription as well as the expression of the c-Myc gene (PMID: 11113208; 15073177). Recently identified as a conserved component of pluripotent stem cells, mammalian NCOA5 may contribute to the maintenance of the pluripotent stem cell population (PMID: 24268775).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse, bovine\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag14014 Product name: Recombinant human NCOA5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 112-384 aa of BC056872 Sequence: DMRDSRDPMYRREGSYDRYLRMDDYCRRKDDSYFDRYRDSFDGRGPPGPESQSRAKERLKREERRREELYRQYFEEIQRRFDAERPVDCSVIVVNKQTKDYAESVGRKVRDLGMVVDLIFLNTEVSLSQALEDVSRGGSPFAIVITQQHQIHRSCTVNIMFGTPQEHRNMPQADAMVLVARNYERYKNECREKEREEIARQAAKMADEAILQERERGGPEEGVRGGHPPAIQSLINLLADNRYLTAEETDKIINYLRERKERLMRSSTDSLPG Predict reactive species\nFull Name: nuclear receptor coactivator 5\nCalculated Molecular Weight: 579 aa, 66 kDa\nObserved Molecular Weight: 66 kDa\nGenBank Accession Number: BC056872\nGene Symbol: NCOA5\nGene ID (NCBI): 57727\nRRID: AB_10694674\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9HCD5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869475885225,"sku":"20175-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-20175-1-ap","provider":"Iright","version":"1.0","type":"link"}