{"product_id":"proteintech-20181-1-ap","title":"Proteintech, 20181-1-AP, ERp19 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ERp19 (20181-1-AP) by Proteintech is a Polyclonal antibody targeting ERp19 in WB, IHC, ELISA applications with reactivity to human samples\n20181-1-AP targets ERp19 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A172 cells, LN-229 cells,  U-251 cells\nPositive IHC detected in: human liver cancer tissue, human hepatocirrhosis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTXNDC12, which is known as thioredoxin domain-containing protein 12, ERp16, ERp18, ERp19, or hTLP19, is a member of the protein disulfide isomerase (PDI) family that plays important roles in cancer development and progression. TXNDC12 has been demonstrated to contribute to tumorigenicity in human gastric cancer by promoting cell growth, migration, and invasion(PMID: 25940440). Other studies also revealed the overexpression of TXNDC12 promotes HCC metastasis through β-catenin-mediated induction of EMT and that TXNDC12 has the potential to be a prognostic factor and therapeutic target of HCC. (PMID: 31570854)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag14045 Product name: Recombinant human TXNDC12 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-172 aa of BC001493 Sequence: METRPRLGATCLLGFSFLLLVISSDGHNGLGKGFGDHIHWRTLEDGKKEAAASGLPLMVIIHKSWCGACKALKPKFAESTEISELSHNFVMVNLEDEEEPKDEDFSPDGGYIPRILFLDPSGKVHPEIINENGNPSYKYFYVSAEQVVQGMKEAQERLTGDAFRKKHLEDEL Predict reactive species\nFull Name: thioredoxin domain containing 12 (endoplasmic reticulum)\nCalculated Molecular Weight: 172 aa, 19 kDa\nObserved Molecular Weight: 20 kDa, 40 kDa\nGenBank Accession Number: BC001493\nGene Symbol: TXNDC12\nGene ID (NCBI): 51060\nRRID: AB_10646468\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O95881\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869679898793,"sku":"20181-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-20181-1-ap","provider":"Iright","version":"1.0","type":"link"}