{"product_id":"proteintech-20284-1-ap","title":"Proteintech, 20284-1-AP, RADIL Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RADIL (20284-1-AP) by Proteintech is a Polyclonal antibody targeting RADIL in WB, IP, ELISA applications with reactivity to human, mouse samples\n20284-1-AP targets RADIL in WB, IP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, SH-SY5Y cells,  mouse testis tissue\nPositive IP detected in: HEK-293 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRadil is a broadly expressed adapter protein that contains a RA-like domain, a PDZ domain and a DIL domain. Like RAPL and RIAM, Radil interacts preferentially with active GTP-bound Rap1, and overexpression of Radil enhances integrin-mediated adhesion. In addition, Radil knockdown inhibits cell-substrate adhesion in HT1080, AD293, and NMuMG cells and results in migration defects in SW1353 and zebrafish neural crest cells (PMID: 17704304). Radil regulates neutrophil adhesion by specifically enhancing β2-integrin activation, as well as focal adhesion kinase (FAK) and paxillin phosphorylation (PMID: 23097489).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag13996 Product name: Recombinant human RADIL protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 776-1075 aa of BC004919 Sequence: IVLPSDGFQVDLEANCLDDSIYQHLLYVRHFLWGLRSRASPGSPGRPGSGASQPVCPEGMHHVVLDGHLEAPSCPLAPRDPGPAAREVAPERTLPLRGAPWAQAPPGRQPGRGGSQAGPPHTDSSCLLTPPSTPLGPEPGDPDWPESGGPCGKALPERQRNGPSGLRGAAPEGDSAALAEESPPAPSSRSSSTEDFCYVFTVELERGPSGLGMGLIDGMHTHLGAPGLYIQTLLPGSPAAADGRLSLGDRILEVNGSSLLGLGYLRAVDLIRHGGKKMRFLVAKSDVETAKKIHFRTPPL Predict reactive species\nFull Name: Ras association and DIL domains\nCalculated Molecular Weight: 1075 aa, 117 kDa\nObserved Molecular Weight: 117 kDa\nGenBank Accession Number: BC004919\nGene Symbol: RADIL\nGene ID (NCBI): 55698\nRRID: AB_10732684\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96JH8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869580021929,"sku":"20284-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-20284-1-ap","provider":"Iright","version":"1.0","type":"link"}