{"product_id":"proteintech-20299-1-ap","title":"Proteintech, 20299-1-AP, SLC6A8 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SLC6A8 (20299-1-AP) by Proteintech is a Polyclonal antibody targeting SLC6A8 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat samples\n20299-1-AP targets SLC6A8 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse heart tissue, HUVEC cells,  mouse kidney tissue,  rat heart tissue,  rat kidney tissue\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:300-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSLC6A8, also known as the sodium- and chloride-dependent creatine transporter 1 (CT1), plays a critical role in transporting creatine, a crucial molecule for energy metabolism, into cells. SLC6A8 belongs to the solute carrier family 6 (SLC6), responsible for transporting diverse molecules across cell membranes. SLC6A8 expression is highest in muscle, kidney, and other tissues with high energy demands. Mutations in SLC6A8 cause creatine transporter deficiency, an X-linked mental retardation disorder (PMID: 17465020).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, bovine\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag14110 Product name: Recombinant human SLC6A8 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 541-635 aa of BC012355 Sequence: YYEPLVYNNTYVYPWWGEAMGWAFALSSMLCVPLHLLGCLLRAKGTMAERWQHLTQPIWGLHHLEYRAQDADVRGLTTLTPVSESSKVVVVESVM Predict reactive species\nFull Name: solute carrier family 6 (neurotransmitter transporter, creatine), member 8\nCalculated Molecular Weight: 635 aa, 71 kDa\nObserved Molecular Weight: 65-70 kDa\nGenBank Accession Number: BC012355\nGene Symbol: SLC6A8\nGene ID (NCBI): 6535\nRRID: AB_2878665\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P48029\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868877574313,"sku":"20299-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-20299-1-ap","provider":"Iright","version":"1.0","type":"link"}