{"product_id":"proteintech-20306-1-ap","title":"Proteintech, 20306-1-AP, GPR65 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GPR65 (20306-1-AP) by Proteintech is a Polyclonal antibody targeting GPR65 in IHC, ELISA applications with reactivity to human samples\n20306-1-AP targets GPR65 in IHC, IF, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: mouse spleen tissue, human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGPR65 (G protein-coupled receptor 65) was defined originally as T-cell death-associated gene 8 (TDAG8), functions as a proton-sensing receptor, and is also sensitive to psychosine (PMID: 35343079). GPR65 promotes adaptation to an acidic environment to enhance cell survival and proliferation, thereby promoting tumor development (PMID: 36852075).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag14139 Product name: Recombinant human GPR65 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 238-337 aa of BC035633 Sequence: CFTPFHVMLLIRCILEHAVNFEDHSNSGKRTYTMYRITVALTSLNCVADPILYCFVTETGRYDMWNILKFCTGRCNTSQRQRKRILSVSTKDTMELEVLE Predict reactive species\nFull Name: G protein-coupled receptor 65\nCalculated Molecular Weight: 337 aa, 39 kDa\nGenBank Accession Number: BC035633\nGene Symbol: GPR65\nGene ID (NCBI): 8477\nRRID: AB_2878668\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8IYL9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869689434281,"sku":"20306-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-20306-1-ap","provider":"Iright","version":"1.0","type":"link"}