{"product_id":"proteintech-20311-1-ap","title":"Proteintech, 20311-1-AP, Tetranectin Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Tetranectin (20311-1-AP) by Proteintech is a Polyclonal antibody targeting Tetranectin in WB, IF\/ICC, IP, ELISA applications with reactivity to human samples\n20311-1-AP targets Tetranectin in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human plasma tissue\nPositive IP detected in: human plasma tissue\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nC-Type Lectin Domain Family 3 Member B (CLEC3B) is a transmembrane Ca2+-binding protein, locating in cell plasma, extracellular matrix and exosomes. Downregulation of CLEC3B has been reported in various diseases. It was demonstrated in CLEC3B-deficient mice that the absence of CLEC3B impeded the mineralization process in osteogenesis. (PMID: 31477130)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag14147 Product name: Recombinant human CLEC3B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 78-202 aa of BC011024 Sequence: HMKCFLAFTQTKTFHEASEDCISRGGTLSTPQTGSENDALYEYLRQSVGNEAEIWLGLNDMAAEGTWVDMTGARIAYKNWETEITAQPDGGKTENCAVLSGAANGKWFDKRCRDQLPYICQFGIV Predict reactive species\nFull Name: C-type lectin domain family 3, member B\nCalculated Molecular Weight: 202 aa, 22 kDa\nObserved Molecular Weight: 22 kDa\nGenBank Accession Number: BC011024\nGene Symbol: CLEC3B\nGene ID (NCBI): 7123\nRRID: AB_2878670\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P05452\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869776269481,"sku":"20311-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-20311-1-ap","provider":"Iright","version":"1.0","type":"link"}