{"product_id":"proteintech-20313-1-ap","title":"Proteintech, 20313-1-AP, GBE1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GBE1 (20313-1-AP) by Proteintech is a Polyclonal antibody targeting GBE1 in WB, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n20313-1-AP targets GBE1 in WB, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: L02 cells, human skeletal muscle tissue,  mouse liver tissue,  rat liver tissue\nPositive IP detected in: L02 cells\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGBE1 (glucan (1,4-alpha-), branching enzyme 1)  is essential for the globular and branched structure of glycogen, increasing solubility by creating a hydrophilic surface and reducing intracellular osmotic pressure. It may serve as a potential therapeutic target for treating LUAD(PMID: 31221150). The full sequence can be further processed into a mature form of 75 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag14154 Product name: Recombinant human GBE1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-302 aa of BC012098 Sequence: MAAPMTPAARPEDYEAALNAALADVPELARLLEIDPYLKPYAVDFQRRYKQFSQILKNIGENEGGIDKFSRGYESFGVHRCADGGLYCKEWAPGAEGVFLTGDFNGWNPFSYPYKKLDYGKWELYIPPKQNKSVLVPHGSKLKVVITSKSGEILYRISPWAKYVVREGDNVNYDWIHWDPEHSYEFKHSRPKKPRSLRIYESHVGISSHEGKVASYKHFTCNVLPRIKGLGYNCIQLMAIMEHAYYASFGYQITSFFAASSRYGSPEELQELVDTAHSMGIIVLLDVVHSHASKNSADGLNM Predict reactive species\nFull Name: glucan (1,4-alpha-), branching enzyme 1\nCalculated Molecular Weight: 702 aa, 80 kDa\nObserved Molecular Weight: 72 kDa\nGenBank Accession Number: BC012098\nGene Symbol: GBE1\nGene ID (NCBI): 2632\nRRID: AB_10697658\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q04446\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868917584041,"sku":"20313-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-20313-1-ap","provider":"Iright","version":"1.0","type":"link"}