{"product_id":"proteintech-20326-1-ap","title":"Proteintech, 20326-1-AP, MEF2C Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MEF2C (20326-1-AP) by Proteintech is a Polyclonal antibody targeting MEF2C in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat samples\n20326-1-AP targets MEF2C in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells,  mouse small intestine tissue,  mouse testis tissue,  rat lymph tissue,  SH-SY5Y cells\nPositive IHC detected in: human heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMEF2C belongs to the MEF2 family. It is a transcription activator which binds specifically to the MEF2 element present in the regulatory regions of many muscle-specific genes. MEF2C controls cardiac morphogenesis and myogenesis, and is also involved in vascular development[PMID: 20221419]. It plays an essential role in hippocampal-dependent learning and memory by suppressing the number of excitatory synapses and thus regulating basal and evoked synaptic transmission[PMID:18599438]. It is crucial for normal neuronal development, distribution, and electrical activity in the neocortex and is necessary for proper development of megakaryocytes and platelets and for bone marrow B lymphopoiesis[PMID: 21666133]. This protein is required for B-cell survival and proliferation in response to BCR stimulation, efficient IgG1 antibody responses to T-cell-dependent antigens and for normal induction of germinal center B cells. It may also be involved in neurogenesis and in the development of cortical architecture. MEF2C exists some isoforms with MV 50-52 kDa, 47 kDa, and 45 kDa, but modified MEF2C is about 55-66 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag13255 Product name: Recombinant human MEF2C protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-162 aa of BC026341 Sequence: PSLQRNSMSPGVTHRPPSAGNTGGLMGGDLTSGAGTSAGNGYGNPRNSPGLLVSPGNLNKNMQAKSPPPMNLGMNNRKPDLRVLIPPGSKNTMPSVSEDVDLLLNQRINNSQSAQSLATPVVSVATPTLPGQGMGGYPSAISTTYGTEYSLSSADLSSLSGF Predict reactive species\nFull Name: myocyte enhancer factor 2C\nCalculated Molecular Weight: 469 aa, 51 kDa\nObserved Molecular Weight: 45-70 kDa\nGenBank Accession Number: BC026341\nGene Symbol: MEF2C\nGene ID (NCBI): 4208\nRRID: AB_10693772\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q06413\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887716454569,"sku":"20326-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-20326-1-ap","provider":"Iright","version":"1.0","type":"link"}