{"product_id":"proteintech-20334-1-ap","title":"Proteintech, 20334-1-AP, AQP5 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe AQP5 (20334-1-AP) by Proteintech is a Polyclonal antibody targeting AQP5 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat samples\n20334-1-AP targets AQP5 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse lung tissue, rat lung tissue\nPositive IHC detected in: mouse lung tissue, mouse kidney tissue,  rat kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: rat lung tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:2500-1:10000\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nAQP5 is a member of aquaporins (AQPs) which are membrane proteins functioning as water channels and involved in the bidirectional transfer of water and small solutes across cell membranes. AQP5 is widely expressed including digestive, renal, respiratory, and reproductive systems. AQP5 overexpression in cancer cells and tumor tissues has been extensively reported. Recently AQP5 has been identified as a marker for adult pyloric stem cells.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, chicken\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag14103 Product name: Recombinant human AQP5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 190-265 aa of BC032946 Sequence: FGPAVVMNRFSPAHWVFWVGPIVGAVLAAILYFYLLFPNSLSLSERVAIIKGTYEPDEDWEEQREERKKTMELTTR Predict reactive species\nFull Name: aquaporin 5\nCalculated Molecular Weight: 265 aa, 28 kDa\nObserved Molecular Weight: 27 kDa\nGenBank Accession Number: BC032946\nGene Symbol: AQP5\nGene ID (NCBI): 362\nRRID: AB_2918066\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P55064\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868870791337,"sku":"20334-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-20334-1-ap","provider":"Iright","version":"1.0","type":"link"}