{"product_id":"proteintech-20339-1-ap","title":"Proteintech, 20339-1-AP, YBX1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe YBX1 (20339-1-AP) by Proteintech is a Polyclonal antibody targeting YBX1 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n20339-1-AP targets YBX1 in WB, IHC, IF\/ICC, IP, CoIP, ChIP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, HeLa cells,  Jurkat cells,  MCF-7 cells,  MDA-MB-231 cells,  NIH\/3T3 cells\nPositive IHC detected in: human renal cell carcinoma tissue, human breast cancer tissue,  human colon cancer tissue,  human placenta tissue,  human prostate cancer tissue,  human tonsillitis tissue,  mouse colon tissue,  rat colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nY box binding protein 1(YBX1) is one of cis-acting elements which has a role in regulation of the expression of HLA class II genes. YBX1 is great of importance in regulation of PTP1B expression. It can bind to splice sites mediate pre-mRNA alternative splicing regulation. Also, it involves the regulation of translation by modulation of the interaction between the mRNA and eukaryotic initiation factors. Its transcriptional activity on the multidrug resistance gene MDR1 is enhanced in presence of the APEX1 acetylated form at 'Lys-6' and 'Lys-7'. The secreted form acts as an extracellular mitogen and stimulates cell migration and proliferation. The calculated molecular weight of YBX1 is 36 kDa, but modified YBX1 is about 36-56 kDa (PMID: 27384875 ). Recently, researchers developed a biomimetic nanoplatform to deliver RNA piR-RCC specifically into RCC tumors. This RNA interacts with YBX1 to inhibit tumor proliferation and metastasis (PMID: 40411401).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, pig\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag14129 Product name: Recombinant human YBX1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 134-303 aa of BC010430 Sequence: QGSKYAADRNHYRRYPRRRGPPRNYQQNYQNSESGEKNEGSESAPEGQAQQRRPYRRRRFPPYYMRRPYGRRPQYSNPPVQGEVMEGADNQGAGEQGRPVRQNMYRGYRPRFRRGPPRQRQPREDGNEEDKENQGDETQGQQPPQRRYRRNFNYRRRRPENPKPQDGKET Predict reactive species\nFull Name: Y box binding protein 1\nCalculated Molecular Weight: 324 aa, 36 kDa\nObserved Molecular Weight: 36-56 kDa\nGenBank Accession Number: BC010430\nGene Symbol: YBX1\nGene ID (NCBI): 4904\nRRID: AB_10665424\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P67809\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868833108137,"sku":"20339-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-20339-1-ap","provider":"Iright","version":"1.0","type":"link"}