{"product_id":"proteintech-20340-1-ap","title":"Proteintech, 20340-1-AP, SLC18A1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SLC18A1 (20340-1-AP) by Proteintech is a Polyclonal antibody targeting SLC18A1 in WB, IHC, ELISA applications with reactivity to human, rat samples\n20340-1-AP targets SLC18A1 in WB, IHC, ELISA applications and shows reactivity with human, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells,  A549 cells,  C6 cells,  HeLa cells,  HepG2 cells\nPositive IHC detected in: human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag14131 Product name: Recombinant human SLC18A1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 43-138 aa of BC009387 Sequence: PIVPTFLYDMEFKEVNSSLHLGHAGSSPHALASPAFSTIFSFFNNNTVAVEESVPSGIAWMNDTASTIPPPATEAISAHKNNCLQGTGFLEEEITR Predict reactive species\nFull Name: solute carrier family 18 (vesicular monoamine), member 1\nCalculated Molecular Weight: 525 aa, 56 kDa\nObserved Molecular Weight: 50 kDa, 56 kDa\nGenBank Accession Number: BC009387\nGene Symbol: SLC18A1\nGene ID (NCBI): 6570\nRRID: AB_10666128\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P54219\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887803912361,"sku":"20340-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-20340-1-ap","provider":"Iright","version":"1.0","type":"link"}