{"product_id":"proteintech-20356-1-ap","title":"Proteintech, 20356-1-AP, TRIM2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TRIM2 (20356-1-AP) by Proteintech is a Polyclonal antibody targeting TRIM2 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n20356-1-AP targets TRIM2 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, mouse small intestine tissue\nPositive IP detected in: mouse brain tissue\nPositive IHC detected in: mouse brain tissue, human kidney tissue,  mouse cerebellum tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: SH-SY5Y cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:12000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:200-1:800\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTripartite motif-containing 2(TRIM2) is an E3 ubiquitin ligase which directs proteasome-mediated degradation of target proteins by the ubiquitination of NEFL and phosphorylation of BCL2L11. This protein contains an N-terminal RING domain, followed by a B-box-2 domain, a coiled-coil region, and 6 C-terminal NHL repeats. TRIM2 involves in the apoptotic response to ischemia via directing degradation of BIM protein, thus has a role in neuroprotection.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag14208 Product name: Recombinant human TRIM2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-300 aa of BC011052 Sequence: MASEGTNIPSPVVRQIDKQFLICSICLERYKNPKVLPCLHTFCERCLQNYIPAHSLTLSCPVCRQTSILPEKGVAALQNNFFITNLMDVLQRTPGSNAEESSILETVTAVAAGKPLSCPNHDGNVMEFYCQSCETAMCRECTEGEHAEHPTVPLKDVVEQHKASLQVQLDAVNKRLPEIDSALQFISEIIHQLTNQKASIVDDIHSTFDELQKTLNVRKSVLLMELEVNYGLKHKVLQSQLDTLLQGQESIKSCSNFTAQALNHGTETEVLLVKKQMSEKLNELADQDFPLHPRENDQLD Predict reactive species\nFull Name: tripartite motif-containing 2\nCalculated Molecular Weight: 744 aa, 82 kDa\nObserved Molecular Weight: 70-85 kDa\nGenBank Accession Number: BC011052\nGene Symbol: TRIM2\nGene ID (NCBI): 23321\nRRID: AB_10734319\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9C040\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868990722217,"sku":"20356-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-20356-1-ap","provider":"Iright","version":"1.0","type":"link"}