{"product_id":"proteintech-20357-1-ap","title":"Proteintech, 20357-1-AP, Secretogranin II Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Secretogranin II (20357-1-AP) by Proteintech is a Polyclonal antibody targeting Secretogranin II in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat samples\n20357-1-AP targets Secretogranin II in WB, IHC, IF-P, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: SH-SY5Y cells\nPositive IHC detected in: mouse pancreas tissue, human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse pancreas tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSCG2, also known as secretogranin II or Chromogranin C, is a member of the chromogranin\/secretogranin family of neuroendocrine secretory proteins. It is widely distributed in nervous and endocrine tissues, and abundant in neuroendocrine granules. In the brain secretogranin II is almost completely processed to secretoneurin, a peptide involved in neurite outgrowth, neuroprotection and neuronal plasticity.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag14215 Product name: Recombinant human SCG2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 418-617 aa of BC022509 Sequence: TPGGAGTEALPDGLSVEDILNLLGMESAANQKTSYFPNPYNQEKVLPRLPYGAGRSRSNQLPKAAWIPHVENRQMAYENLNDKDQELGEYLARMLVKYPEIINSNQVKRVPGQGSSEGDLQEEEQIEQAIKEHLNQGSSQETDKLAPVSKRFPVGPPKNDDTPNRQYWDEDLLMKVLEYLNQEKAEKGREHIAKRAMENM Predict reactive species\nFull Name: secretogranin II (chromogranin C)\nCalculated Molecular Weight: 617 aa, 71 kDa\nObserved Molecular Weight: 71 kDa\nGenBank Accession Number: BC022509\nGene Symbol: Chromogranin C\/SGII\nGene ID (NCBI): 7857\nRRID: AB_10699881\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P13521\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868920926377,"sku":"20357-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-20357-1-ap","provider":"Iright","version":"1.0","type":"link"}