{"product_id":"proteintech-20403-1-ap","title":"Proteintech, 20403-1-AP, GLUT3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GLUT3 (20403-1-AP) by Proteintech is a Polyclonal antibody targeting GLUT3 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n20403-1-AP targets GLUT3 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, U-251 cells,  Jurkat cells,  HeLa cells,  C6 cells,  mouse brain tissue,  rat brain tissue,  HepG2 cells\nPositive IHC detected in: mouse testis tissue, human lung cancer tissue,  human breast cancer tissue,  human placenta tissue,  mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: Caco-2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunohistochemistry (IHC): IHC : 1:2000-1:8000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGlucose transporter 3 (GLUT3), also known as solute carrier family 2, facilitated glucose transporter member 3 (SLC2A3), is a transporter protein regulating glucose transport across cell membranes and is a primary glucose transporter in neurons.What is the molecular weight of GLUT3? Is GLUT3 post-translationally modified?The molecular weight of GLUT3 transporter is 49-52 kDa and depends on the glycosylation pattern, which is tissue-specific (PMID: 9253355 and 9889355). GLUT3 can be N-glycosylated.What is the subcellular localization of GLUT3?Glucose transporters, including GLUT3, are multiple-pass integral membrane proteins. GLUT3 is present at the plasma membrane but is also a subject of recycling between the plasma membrane and endosomes.What molecules can be transported by GLUT3?Although the main substrate of GLUT3 transport is glucose, it can also transport mannose, galactose, and xylose.What is the tissue expression pattern of GLUT3?GLUT1 and GLUT3 are important for the transport of glucose into the central nervous system. While GLUT1 transports glucose through blood vessels and into astrocytes, GLUT3 is predominantly expressed in neurons, being their main glucose transporter (PMID: 9302083), and in testis (PMID: 18577699).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, goat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag14203 Product name: Recombinant human SLC2A3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 207-281 aa of BC039196 Sequence: ESPRFLLINRKEEENAKQILQRLWGTQDVSQDIQEMKDESARMSQEKQVTVLELFRVSSYRQPIIISIVLQLSQQ Predict reactive species\nFull Name: solute carrier family 2 (facilitated glucose transporter), member 3\nCalculated Molecular Weight: 496 aa, 54 kDa\nObserved Molecular Weight: 54-60 kDa\nGenBank Accession Number: BC039196\nGene Symbol: GLUT3\nGene ID (NCBI): 6515\nRRID: AB_10694437\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P11169\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868832616617,"sku":"20403-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-20403-1-ap","provider":"Iright","version":"1.0","type":"link"}